"event" : "MessagesWidgetCommentForm", "event" : "addMessageUserEmailSubscription", "actions" : [ "eventActions" : [ { "context" : "", { "action" : "pulsate" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, } "actions" : [ "displaySubject" : "true", "context" : "envParam:quiltName,message,product,contextId,contextUrl", { ] "event" : "AcceptSolutionAction", "truncateBody" : "true", { ] }, } } Du findest Deine PUK/Super PIN auch in MeinVodafone. "}); }, ] "action" : "rerender" "kudosLinksDisabled" : "false", } }); "event" : "addThreadUserEmailSubscription", }, "messageViewOptions" : "1111110111111111111110111110100101001101" { return; { Das geht alles mit der App ☝. "context" : "envParam:selectedMessage", "revokeMode" : "true", }, "initiatorDataMatcher" : "data-lia-kudos-id" // If watching, pay attention to key presses, looking for right sequence. "action" : "rerender" count = 0; "action" : "rerender" "actions" : [ $('#node-menu li.active').children('ul').show(); { { ] } } LITHIUM.AjaxSupport.fromLink('#kudoEntity_5', 'kudoEntity', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {}, '-ut_viuuUNppqEFvq9stPZbfAV8llwrAqj0I6h0oBoo. } { ] "event" : "QuickReply", } ;(function($) { ;(function($) { "initiatorDataMatcher" : "data-lia-message-uid" "event" : "MessagesWidgetAnswerForm", "event" : "editProductMessage", "action" : "pulsate" }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1574243 .lia-rating-control-passive', '#form_5'); { "action" : "rerender" } "event" : "deleteMessage", { "disableLabelLinks" : "false", "event" : "kudoEntity", } }, lithstudio: [], "selector" : "#kudosButtonV2_1", }, "activecastFullscreen" : false, "event" : "removeThreadUserEmailSubscription", ], }, $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); ] "actions" : [ ] "actions" : [ if ( !watching ) { "event" : "addThreadUserEmailSubscription", { "event" : "removeMessageUserEmailSubscription", { { "event" : "MessagesWidgetEditAnswerForm", "actions" : [ LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating'); "forceSearchRequestParameterForBlurbBuilder" : "false", "action" : "rerender" { { "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ } "dialogContentCssClass" : "lia-panel-dialog-content", count = 0; "event" : "deleteMessage", { { "componentId" : "forums.widget.message-view", "actions" : [ ] }, "useSubjectIcons" : "true", "displayStyle" : "horizontal", "closeEvent" : "LITHIUM:lightboxCloseEvent", ;(function($) { "event" : "ProductMessageEdit", "actions" : [ "event" : "editProductMessage", "parameters" : { .attr('aria-hidden','true') "selector" : "#messageview_3", "action" : "rerender" "action" : "rerender" "event" : "MessagesWidgetAnswerForm", "showCountOnly" : "false", "componentId" : "kudos.widget.button", } "eventActions" : [ "eventActions" : [ ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { if($('body.lia-window-scroll #vodafone-community-header .lia-search-input-wrapper').css('opacity') > 0) { { ] "action" : "rerender" }, "useTruncatedSubject" : "true", "action" : "rerender" } // We're good so far. { } "parameters" : { ], { })(LITHIUM.jQuery); "event" : "MessagesWidgetMessageEdit", "kudosLinksDisabled" : "false", "componentId" : "kudos.widget.button", }, }, "actions" : [ { "useSimpleView" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ "eventActions" : [ }, { }, { Hallo, habe nach dem Update der Mein Vodafone App Probleme diese zu öffnen, bei Benutzung der App ist der Bildschirm rot und das Logo fängt kurz an sich aufzubauen und das war es dann schon. ] ] "event" : "AcceptSolutionAction", "actions" : [ } { $(document).keydown(function(e) { "truncateBodyRetainsHtml" : "false", })(LITHIUM.jQuery); // Pull in global jQuery reference ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ], } "parameters" : { "action" : "rerender" "initiatorBinding" : true, } { "context" : "", "action" : "rerender" "event" : "ProductAnswer", "context" : "", { { "actions" : [ "disableLabelLinks" : "false", LITHIUM.InputEditForm("form", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "event" : "deleteMessage", "action" : "rerender" "context" : "", ] "action" : "addClassName" "context" : "envParam:quiltName", "actions" : [ { "context" : "", "action" : "rerender" { "event" : "MessagesWidgetEditCommentForm", "initiatorDataMatcher" : "data-lia-kudos-id" "useSubjectIcons" : "true", "action" : "rerender" ] { "action" : "pulsate" "actions" : [ "actions" : [ ], "event" : "removeThreadUserEmailSubscription", "event" : "MessagesWidgetMessageEdit", "eventActions" : [ }, "action" : "rerender" } } "context" : "envParam:selectedMessage", { $('#vodafone-community-header .lia-search-toggle').click(function() { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ } ] LITHIUM.AjaxSupport.ComponentEvents.set({ } "context" : "envParam:quiltName,message,product,contextId,contextUrl", "context" : "", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1574243 .lia-rating-control-passive', '#form_5'); "displaySubject" : "true", }, "disallowZeroCount" : "false", "selector" : "#kudosButtonV2", }); window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":678,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaREtXBAdFAUcRDhANQhJJQVg+GDgaVVtAEFtIT10GA1ELW1YaVgBqSU0HPk12FlZbXURIewNQXE80WABUVVtcABsrXFsMT3wFV1ZYbkp7A1BcB09hC1FSUl0LU0t4QhJPRBBUQUBXERsIUFEKFmtLQVcZQjkZVwwAVFEEUBcfFlQXVwtcewZADVUHBwILUQJVAAZVVBtGXlBhQQBEL10QWE8GSBdYV2IEUQN3Uw8HFV4XdVtAEFsyVkILAWcFUlYWHkddBXRdAAtbARcJFlQEWhVcEE5AXAd3XEAQXxQAWF4RBxVIF1hXZh0UXBsCA1sGAANSUR8EBVEKH1YDD10YCgBXVxtTXQcABg5RBFJVBVQUShtZASxYAFB6UBBfFCdLUQoLQSlQWlpkClIHX10MB3oBXF1\/UwdTCnx\/AwtbRhkRX1E3UxVNZFAzQgFHShYIR2UjdXchNhcNURNyYCp7RlRXERFWA1BAFGUtczR8EhYNRw1WHV1WWAlGdXsvK2NEChFJTw=="}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; } ] { { "event" : "removeMessageUserEmailSubscription", "context" : "", } "context" : "envParam:quiltName,message,product,contextId,contextUrl", }, "actions" : [ { ] { if($('body.lia-window-scroll #vodafone-community-header .lia-search-input-wrapper').css('opacity') > 0) { }, { "parameters" : { }, "actions" : [ { "initiatorBinding" : true, "useCountToKudo" : "false", }, "context" : "", "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", count = 0; "event" : "addThreadUserEmailSubscription", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "rerender" } ] "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" "truncateBody" : "true", } } LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1573018 .lia-rating-control-passive', '#form_1'); { { "actions" : [ }, { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_21","feedbackSelector":".InfoMessage"}); "event" : "removeMessageUserEmailSubscription", "action" : "rerender" if ( !watching ) { "context" : "envParam:quiltName,message", { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_1","menuItemsSelector":".lia-menu-dropdown-items"}}); "}); ] ] "event" : "deleteMessage", } { "context" : "", "disableKudosForAnonUser" : "false", "context" : "envParam:entity", { "kudosable" : "true", { watching = false; { ] { "actions" : [ "actions" : [ { "context" : "envParam:quiltName,message,product,contextId,contextUrl", ] ] "selector" : "#messageview_3", "action" : "rerender" }); "context" : "", "disableLinks" : "false", ] { ', 'ajax'); "actions" : [ \\n\\t\\t\\t\\t\\t\\tDer gewünschte Vorgang konnte leider nicht abgeschlossen werden.\\n\\t\\t\\t\\t\\t\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\n\\n\\t\\t\\t\\n\\t\\t\";LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_1edccd722c2ae1', 'disableAutoComplete', '#ajaxfeedback_1edccd7200bcbf_0', 'LITHIUM:ajaxError', {}, 'OxCqA1PdYHSxLjFUYrhIVteSwO9FSiJgL9uzhdhzT8o. { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "activecastFullscreen" : false, "event" : "removeThreadUserEmailSubscription", "event" : "addThreadUserEmailSubscription", "action" : "rerender" })(LITHIUM.jQuery); "event" : "MessagesWidgetCommentForm", } }, } { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "useTruncatedSubject" : "true", "event" : "removeMessageUserEmailSubscription", })(LITHIUM.jQuery); { { "action" : "rerender" { // We're good so far. Bitte versuche mal über die Einstellungen - Apps - Speicher, den Speicher zu löschen und Cache zu leeren. "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } LITHIUM.StarRating('#any_2', false, 1, 'LITHIUM:starRating'); "revokeMode" : "true", }, "context" : "envParam:feedbackData", window.location.replace('/t5/user/userloginpage'); "action" : "rerender" "showCountOnly" : "false", { "event" : "ProductAnswerComment", "}); }, } "event" : "ProductAnswer", ] "actions" : [ "componentId" : "kudos.widget.button", "action" : "rerender" ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_32","feedbackSelector":".InfoMessage"}); { $(document).ready(function(){ ] }, ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { ;(function($) { "actions" : [ }); LITHIUM.MessageBodyDisplay('#bodyDisplay_0', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); }, ] { }, }, } ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ { "context" : "envParam:quiltName", { LITHIUM.AjaxSupport.useTickets = false; "actions" : [ }, { "useCountToKudo" : "false", } ] "truncateBody" : "true", element.addClass('active'); Bewertet hilfreiche Beiträge mit Likes und Sternen!Unaufgeforderte PNs werden nicht beantwortet - Bitte erstellt einen Thread. "context" : "envParam:feedbackData", ] "action" : "rerender" } "context" : "", "event" : "addThreadUserEmailSubscription", "context" : "", "actions" : [ { }, }, "actions" : [ "context" : "envParam:quiltName,message", "entity" : "1574219", "event" : "removeMessageUserEmailSubscription", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "useCountToKudo" : "false", }); "action" : "rerender" })(LITHIUM.jQuery); "event" : "addThreadUserEmailSubscription", "disableKudosForAnonUser" : "false", { LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, 'lnDiHOPCyDZPAdvh7BMYPuUSECwsoLR6qlL4xRx9INw. "context" : "", "displayStyle" : "horizontal", } // We're good so far. "action" : "rerender" "context" : "envParam:quiltName,message,product,contextId,contextUrl", ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); Schalten Sie Ihr iPhone oder iPad komplett aus und starten Sie es anschließend wieder. "truncateBody" : "true", }, "event" : "MessagesWidgetMessageEdit", LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "", "action" : "rerender" Tritt der Fehler nur bei einer App auf, löschen Sie die Anwendung einfach und laden Sie diese anschließend erneut aus dem App Store herunter. } }, "context" : "", // console.log('watching: ' + key); "event" : "ProductAnswer", "actions" : [ "action" : "rerender" { ] "useTruncatedSubject" : "true", Die Community hilft!#bleibtgesund. } } "action" : "rerender" { LITHIUM.MessageBodyDisplay('#bodyDisplay_4', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { ] "action" : "rerender" } "event" : "editProductMessage", "actions" : [ "action" : "rerender" "action" : "rerender" }, "action" : "rerender" ] ] "context" : "", { "componentId" : "kudos.widget.button", "action" : "addClassName" "disallowZeroCount" : "false", } })(LITHIUM.jQuery); "actions" : [ "context" : "", hat dies empfohlen. { "parameters" : { "messageViewOptions" : "1111110111111111111110111110100101001101" { { "action" : "rerender" LITHIUM.Dialog({ "messageViewOptions" : "1111110111111111111110111110100101011101" "context" : "envParam:quiltName,expandedQuiltName", { { "context" : "", "eventActions" : [ "action" : "rerender" ] "action" : "rerender" "event" : "deleteMessage", "includeRepliesModerationState" : "false", ] "actions" : [ "action" : "rerender" "initiatorBinding" : true, "actions" : [ "action" : "rerender" ], { "context" : "envParam:quiltName", ] ;(function($) { ] }, { }, "activecastFullscreen" : false, }, }, $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "showCountOnly" : "false", ] "context" : "lia-deleted-state", }, ] { { "event" : "MessagesWidgetAnswerForm", { }, }, }, "event" : "addMessageUserEmailSubscription", "componentId" : "forums.widget.message-view", ], { LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; } "entity" : "1574120", "quiltName" : "ForumMessage", watching = true; Bist du sicher, dass du fortfahren möchtest? "event" : "MessagesWidgetAnswerForm", }, "action" : "rerender" "event" : "markAsSpamWithoutRedirect", var count = 0; "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, ] "disableKudosForAnonUser" : "false", "actions" : [ "includeRepliesModerationState" : "false", } "useCountToKudo" : "false", "event" : "ProductAnswerComment", LITHIUM.InputEditForm("form_4", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } { "action" : "rerender" }, Geh mit Deinem Smartphone einmal über Mobile Daten ins Internet und starte die MeinVodafone-App. "context" : "", "action" : "rerender" { }); "action" : "rerender" ] { }); }, "event" : "MessagesWidgetCommentForm", ] "context" : "envParam:quiltName", } } ] }, { "componentId" : "kudos.widget.button", "actions" : [ { "action" : "rerender" { } { ] "context" : "lia-deleted-state", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }, }, { { { "context" : "", ] })(LITHIUM.jQuery); "actions" : [ }, { "action" : "rerender" window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":678,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaREtXBAdFAUcRDhANQhJJQVg+GDgaVVtAEFtIT10GA1ELW1YaVgBqSU0HPk12FlZbXURIewNQXE80WABUVVtcABsrXFsMT3wFV1ZYbkp7A1BcB09hC1FSUl0LU0t4QhJPRBBUQUBXERsIUFEKFmtLQVcZQjkZVwwAVFEEUBcfFlQXVwtcewZADVUHBwILUQJVAAZVVBtGXlBhQQBEL10QWE8GSBdYV2IEUQN3Uw8HFV4XdVtAEFsyVkILAWcFUlYWHkddBXRdAAtbARcJFlQEWhVcEE5AXAd3XEAQXxQAWF4RBxVIF1hXZh0UXBsCA1sGAANSUR8EBVEKH1YDD10YCgBXVxtTXQcABg5RBFJVBVQUShtZASxYAFB6UBBfFCdLUQoLQSlQWlpkClIHX10MB3oBXF1\/UwdTCnx\/AwtbRhkRX1E3UxVNZFAzQgFHShYIR2UjdXchNhcNURNyYCp7RlRXERFWA1BAFGUtczR8EhYNRw1WHV1WWAlGdXsvK2NEChFJTw=="}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; LITHIUM.Dialog({ "truncateBodyRetainsHtml" : "false", { { "actions" : [ { "event" : "expandMessage", "action" : "rerender" "context" : "envParam:quiltName,message,product,contextId,contextUrl", "actions" : [ } } "context" : "", }, }, "context" : "", }, "}); "parameters" : { } ] "context" : "", LITHIUM.StarRating('#any_0', true, 2, 'LITHIUM:starRating'); { "selector" : "#kudosButtonV2_2", "actions" : [ "actions" : [ "activecastFullscreen" : false, $(this).next().toggle(); }, "action" : "rerender" "disableLabelLinks" : "false", }, "context" : "", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "action" : "rerender" "actions" : [ "}); "triggerSelector" : ".lia-panel-dialog-trigger-event-click", ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); "truncateBodyRetainsHtml" : "false", { ] "parameters" : { { "actions" : [ { "context" : "", "disableKudosForAnonUser" : "false", "truncateBodyRetainsHtml" : "false", "action" : "pulsate" ] LITHIUM.MessageBodyDisplay('#bodyDisplay_4', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "action" : "rerender" LITHIUM.StarRating('#any_2', false, 1, 'LITHIUM:starRating'); "quiltName" : "ForumMessage", "messageViewOptions" : "1111110111111111111110111110100101001101" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1574219 .lia-rating-control-passive', '#form_4'); ] } ', 'ajax'); } "action" : "pulsate" ', 'ajax'); ] ] { window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":678,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaREtXBAdFAUcRDhANQhJJQVg+GDgaVVtAEFtIT10GA1ELW1YaVgBqSU0HPk12FlZbXURIewNQXE80WABUVVtcABsrXFsMT3wFV1ZYbkp7A1BcB09hC1FSUl0LU0t4QhJPRBBUQUBXERsIUFEKFmtLQVcZQjkZVwwAVFEEUBcfFlQXVwtcewZADVUHBwILUQJVAAZVVBtGXlBhQQBEL10QWE8GSBdYV2IEUQN3Uw8HFV4XdVtAEFsyVkILAWcFUlYWHkddBXRdAAtbARcJFlQEWhVcEE5AXAd3XEAQXxQAWF4RBxVIF1hXZh0UXBsCA1sGAANSUR8EBVEKH1YDD10YCgBXVxtTXQcABg5RBFJVBVQUShtZASxYAFB6UBBfFCdLUQoLQSlQWlpkClIHX10MB3oBXF1\/UwdTCnx\/AwtbRhkRX1E3UxVNZFAzQgFHShYIR2UjdXchNhcNURNyYCp7RlRXERFWA1BAFGUtczR8EhYNRw1WHV1WWAlGdXsvK2NEChFJTw=="}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "event" : "ProductAnswerComment", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1574152 .lia-rating-control-passive', '#form_3'); { "event" : "AcceptSolutionAction", "componentId" : "forums.widget.message-view", "useTruncatedSubject" : "true", ] "actions" : [ count = 0; expireDate.setDate(expireDate.getDate() + 365*10); } "truncateBody" : "true", ] "useSimpleView" : "false", ] })(LITHIUM.jQuery); { ] } "action" : "rerender" "context" : "", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); }, ] { "action" : "rerender" { "context" : "envParam:feedbackData", }); "context" : "envParam:feedbackData", ] "actions" : [ }, $(this).toggleClass("view-btn-open view-btn-close"); { "context" : "envParam:quiltName,message,product,contextId,contextUrl", ] "forceSearchRequestParameterForBlurbBuilder" : "false", LITHIUM.Dialog.options['553595914'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; "actions" : [ ] "eventActions" : [ "selector" : "#kudosButtonV2_1", { "action" : "rerender" { "context" : "", "actions" : [ "action" : "rerender" }); "useTruncatedSubject" : "true", }, "context" : "envParam:quiltName,expandedQuiltName", "context" : "envParam:quiltName", "actions" : [ "event" : "MessagesWidgetEditCommentForm", "dialogKey" : "dialogKey" "event" : "MessagesWidgetEditAnswerForm", "context" : "envParam:quiltName,product,contextId,contextUrl", { "}); }, "messageViewOptions" : "1111110111111111111110111110100101001101" ] { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1574152,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ { { ] "message" : "1574243", ;(function($) { "event" : "MessagesWidgetCommentForm", "event" : "markAsSpamWithoutRedirect", "action" : "rerender" } else { ] "useCountToKudo" : "false", {

Bav Höchstbeitrag 2021 Arbeitgeberzuschuss, Seltsamer Spazierritt Bilder, Cicero De Officiis übersetzung Gerechtigkeit, Lvr Tagesklinik Mülheim Saarn, Cineplex Aachen Rambo, T5 Bus Camper, Referat Einleitung Beispiel, Latein Prima Lösungen Lektion 44, Ipad Kritzeln Geht Nicht, Cineplex Aachen Rambo, Stundenlohn Bauhelfer Schwarz, Als Deutscher Staatsbürger In Der Türkei Leben,