Deine E-Mail-Adresse wird nicht veröffentlicht. "event" : "MessagesWidgetEditAction", }); "context" : "", "actions" : [ "selector" : "#messageview_5", } "disableKudosForAnonUser" : "false", "action" : "pulsate" "actions" : [ { "event" : "removeMessageUserEmailSubscription", { { "componentId" : "kudos.widget.button", } "revokeMode" : "true", "context" : "", "event" : "QuickReply", Diese IP-Adresse darf von keinem anderen Gerät im FRITZ!Box-Heimnetz verwendet werden. "context" : "envParam:quiltName", { }, "action" : "rerender" "context" : "", { { { { "context" : "", ] { "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_36","feedbackSelector":".InfoMessage"}); "useSimpleView" : "false", { "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_43","feedbackSelector":".InfoMessage"}); return false; } { "event" : "QuickReply", var keycodes = { { "actions" : [ } "actions" : [ { "event" : "removeThreadUserEmailSubscription", { } { LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "closeEvent" : "LITHIUM:lightboxCloseEvent", "actions" : [ // Oops, not the right sequence, lets restart from the top. "event" : "AcceptSolutionAction", }, "context" : "", { { } "event" : "RevokeSolutionAction", { "actions" : [ ] "context" : "lia-deleted-state", }, "actions" : [ }, }); { $(document).keydown(function(e) { }, "context" : "", ] }, "event" : "markAsSpamWithoutRedirect", "initiatorDataMatcher" : "data-lia-message-uid" { "action" : "rerender" "actions" : [ } /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { if ( !watching ) { { }); "displayStyle" : "horizontal", }, "event" : "AcceptSolutionAction", { if (doChecks(pagerId, val)) }, "context" : "envParam:entity", $('#custom-overall-notif-count').html(notifCount); }, LITHIUM.MessageBodyDisplay('#bodyDisplay_6', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "context" : "", }, "event" : "unapproveMessage", } }, "actions" : [ Wir machen Sie fit für die Technologien von morgen und geben Ihnen wertvolle Tipps für Ihren count = 0; }, }); { } Seien Sie vom 27.4.-29.4.2021 live dabei, wenn im Rahmen der Vodafone eleVation DIGITAL DAYS mehr als 100 Speaker und Special Guests auf 3 virtuellen Bühnen über Themen wie digitalen Wandel, New Work und eine nachhaltige Zukunft sprechen. "action" : "pulsate" "action" : "rerender" "event" : "approveMessage", } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_9","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_9","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv/thread-id/273533","ajaxErrorEventName":"LITHIUM:ajaxError","token":"FnR63ZloJZ5IBqEcx51_50Y3vbt-oi571EaT5kQqv8g. "context" : "envParam:quiltName", }, // We're good so far. { LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; ', 'ajax'); ] LITHIUM.MessageBodyDisplay('#bodyDisplay_3', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "displayStyle" : "horizontal", { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "actions" : [ }, "initiatorBinding" : true, "actions" : [ "includeRepliesModerationState" : "false", { "initiatorDataMatcher" : "data-lia-kudos-id" } "initiatorDataMatcher" : "data-lia-kudos-id" "action" : "rerender" "eventActions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", ] "messageViewOptions" : "1111110111111111111110111110100101001101" }, { { var key = e.keyCode; if ( Number(val) % 1 !== 0 || (String(val).indexOf(".") // If watching, pay attention to key presses, looking for right sequence. "event" : "addMessageUserEmailSubscription", count++; { } { { { "context" : "", } } { { "initiatorBinding" : true, ] { $(this).next().toggle(); "actions" : [ })(LITHIUM.jQuery); ] "context" : "envParam:quiltName", } } "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_44","feedbackSelector":".InfoMessage"}); "action" : "rerender" "componentId" : "kudos.widget.button", Bist du sicher, dass du fortfahren möchtest? "useTruncatedSubject" : "true", ] "action" : "rerender" setWarning(pagerId); "action" : "pulsate" LITHIUM.Cache.CustomEvent.set([{"elementId":"link_8","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1463173}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1465101}},{"elementId":"link_19","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1463193}},{"elementId":"link_23","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1463203}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1463308}},{"elementId":"link_31","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1463319}},{"elementId":"link_35","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1463329}},{"elementId":"link_39","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1463334}},{"elementId":"link_43","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1463354}},{"elementId":"link_47","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1463359}},{"elementId":"link_51","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1463365}}]); "action" : "rerender" $('#node-menu li.has-sub>a').on('click', function(){ ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "event" : "editProductMessage", }, { "actions" : [ document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no"); }, "showCountOnly" : "false", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" { ], "disableLabelLinks" : "false", $(this).next().toggle(); ","loaderSelector":"#lineardisplaymessageviewwrapper_9 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { "; "action" : "rerender" LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; { "actions" : [ { "floatedBlock" : "acceptedSolutions", { sessionStorage.setItem("is_scroll", option); } "context" : "", "kudosLinksDisabled" : "false", } function processPageInputBlur(pagerId, val) "actions" : [ }, "disallowZeroCount" : "false", "context" : "", }, return false; "displaySubject" : "true", { { "}); } { } } { "componentId" : "forums.widget.message-view", } { { { LITHIUM.StarRating('#any_0_7', true, 2, 'LITHIUM:starRating'); "useSimpleView" : "false", "context" : "", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "actions" : [ "truncateBodyRetainsHtml" : "false", }, ], { "action" : "rerender" { "event" : "MessagesWidgetMessageEdit", "event" : "expandMessage", "actions" : [ // console.log('watching: ' + key); LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1463193,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. } ] { "messageViewOptions" : "1111110111111111111110111110100101001101" "action" : "pulsate" "event" : "AcceptSolutionAction", ] "eventActions" : [ }, { ] "actions" : [ { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "useCountToKudo" : "false", } { } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_43","feedbackSelector":".InfoMessage"}); "event" : "MessagesWidgetAnswerForm", { }, { { "action" : "rerender" "context" : "", }, "action" : "rerender" //$('#vodafone-community-header').css('display','block'); "event" : "editProductMessage", $(document).ready(function(){ "accessibility" : false, "action" : "pulsate" "messageViewOptions" : "1111110111111111111110111110100101001101" "context" : "", { LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); ] LITHIUM.AjaxSupport.ComponentEvents.set({ "selector" : "#kudosButtonV2_9", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_49","feedbackSelector":".InfoMessage"}); { ","loaderSelector":"#lineardisplaymessageviewwrapper_9 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ;(function($) { "action" : "rerender" { { } "context" : "", }, { ], "includeRepliesModerationState" : "false", "context" : "envParam:quiltName,expandedQuiltName", }); // We're good so far. ] LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; { "action" : "rerender" "kudosLinksDisabled" : "false", "action" : "rerender" "context" : "", ] { "action" : "rerender" } } LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1463354 .lia-rating-control-passive', '#form_7'); }, window.scrollTo(0,position_x.top - 150); "disallowZeroCount" : "false", "actions" : [ "context" : "envParam:feedbackData", LITHIUM.StarRating('#any_0_9', true, 2, 'LITHIUM:starRating'); "message" : "1463354", LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); { { "event" : "ProductMessageEdit", document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div"); "}); ] { watching = false; } "useSubjectIcons" : "true", "actions" : [ LITHIUM.MessageBodyDisplay('#bodyDisplay_8', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "actions" : [ }); "actions" : [ } { ], { }, { "}); "action" : "rerender" "event" : "MessagesWidgetCommentForm", } "triggerSelector" : ".lia-panel-dialog-trigger-event-click", { }); }, "actions" : [ }, { { { }, "context" : "envParam:quiltName,message,product,contextId,contextUrl", $(document).ready(function(){ "action" : "rerender" "initiatorBinding" : true, }, "actions" : [ ] }, o.innerHTML = "Page number can\'t exceed 2. "actions" : [ "eventActions" : [ LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1463329 .lia-rating-control-passive', '#form_5'); { { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); { clearWarning(pagerId); "context" : "envParam:feedbackData", ] "action" : "rerender" }, } { "event" : "expandMessage", } "action" : "rerender" "initiatorBinding" : true, ], "context" : "envParam:feedbackData", "action" : "rerender" }, ] "event" : "removeThreadUserEmailSubscription", }, ] "action" : "rerender" } "quiltName" : "ForumMessage", > 0) ) { Bist du sicher, dass du fortfahren möchtest? }, "event" : "MessagesWidgetCommentForm",

Vollständige Faktorisierung Rechner, Bewerbung Praktikum Hauswirtschaft, Pavillon Mieten Basel, Kaya Yanar Tour 2020 Abgesagt, Der Wanderer über Dem Nebelmeer Preis, Miles And More Hotel, Wanderweg Gruiten Düsselsoziale Berufe Mit Hauptschulabschluss, Wbs Schulen Standorte,