"initiatorDataMatcher" : "data-lia-message-uid" } "event" : "ProductAnswerComment", }, "context" : "", } "action" : "rerender" "context" : "", ","loaderSelector":"#lineardisplaymessageviewwrapper_9 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); { { "action" : "rerender" { }, "action" : "rerender" }); "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }, "actions" : [ "action" : "rerender" "action" : "rerender" "truncateBodyRetainsHtml" : "false", "action" : "rerender" "event" : "deleteMessage", "event" : "expandMessage", "event" : "addThreadUserEmailSubscription", { watching = false; LITHIUM.AjaxSupport.fromLink('#kudoEntity_9', 'kudoEntity', '#ajaxfeedback_9', 'LITHIUM:ajaxError', {}, 'oSM-EcxwxRNYLoBkVo0hPeJHTMiYb2v8iN7OtJait-I. ], ] }, "; "message" : "1671448", "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "event" : "MessagesWidgetEditCommentForm", } ] { "parameters" : { }, } "truncateBody" : "true", "event" : "removeMessageUserEmailSubscription", "actions" : [ }, { ] "kudosLinksDisabled" : "false", if ( count == neededkeys.length ) { "useSimpleView" : "false", { }, } Bitte nutze IPv6 für den Zugriff auf deine Geräte. ] "kudosLinksDisabled" : "false", { "action" : "rerender" LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'uQBuYZizsR65e103AZGjZW0OSrVIPzyQVKG8SNIk0E4. }, { "eventActions" : [ "action" : "addClassName" "action" : "rerender" } $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }, "context" : "envParam:quiltName,message", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); }, "context" : "", } "actions" : [ } { "actions" : [ "entity" : "1671441", } LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. ] } "actions" : [ { Bist du sicher, dass du fortfahren möchtest? { "forceSearchRequestParameterForBlurbBuilder" : "false", "event" : "addThreadUserEmailSubscription", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); "action" : "rerender" } "event" : "addMessageUserEmailSubscription", "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_51","feedbackSelector":".InfoMessage"}); }, { "eventActions" : [ "truncateBodyRetainsHtml" : "false", "event" : "ProductMessageEdit", { { ] }, "event" : "AcceptSolutionAction", "event" : "editProductMessage", "action" : "rerender" "action" : "addClassName" LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } ] { { LITHIUM.InputEditForm("form_8", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. }, $('#vodafone-community-header .lia-search-input-wrapper').hide(); ;(function($) { return; } }, }); ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); LITHIUM.Dialog({ Traffic Ratios ... All of the AS31334 Customer are now reachable via the Vodafone AS3209. { "event" : "kudoEntity", ] "event" : "approveMessage", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1629608 .lia-rating-control-passive', '#form_7'); "context" : "lia-deleted-state", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "QuickReply", "context" : "lia-deleted-state", ] ', 'ajax'); var msg = $(".message-uid-1637199"); return true; }, "quiltName" : "ForumMessage", ] "event" : "MessagesWidgetMessageEdit", "revokeMode" : "true", } "forceSearchRequestParameterForBlurbBuilder" : "false", "event" : "ProductAnswer", }, { "}); { "action" : "rerender" "parameters" : { "eventActions" : [ "event" : "approveMessage", { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1671400 .lia-rating-control-passive', '#form_4'); } "actions" : [ "action" : "rerender" }, }, }, "context" : "", Bist du sicher, dass du fortfahren möchtest? ] $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "triggerEvent" : "click", "action" : "rerender" ctaHTML += "Lösung noch nicht gefunden? { }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_9","componentSelector":"#lineardisplaymessageviewwrapper_9","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1671846,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { "event" : "ProductAnswer", ] ', 'ajax'); "action" : "rerender" } "eventActions" : [ ', 'ajax'); "kudosable" : "true", "kudosable" : "true", "context" : "", "truncateBody" : "true", "message" : "1629573", "actions" : [ "event" : "RevokeSolutionAction", if (val.trim() == "") "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ } "action" : "rerender" "event" : "MessagesWidgetEditAnswerForm", return false; }, "context" : "", } "displayStyle" : "horizontal", }, { { }, document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("disabled","1"); "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_49","feedbackSelector":".InfoMessage"}); }, { "disallowZeroCount" : "false", "action" : "rerender" "showCountOnly" : "false", "context" : "envParam:entity", } } { "disableLabelLinks" : "false", "context" : "", } "truncateBodyRetainsHtml" : "false", "event" : "approveMessage", "action" : "rerender" "action" : "pulsate" "includeRepliesModerationState" : "false", { ;(function($) { "selector" : "#kudosButtonV2_9", LITHIUM.MessageBodyDisplay('#bodyDisplay_4', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "disallowZeroCount" : "false", }, { "action" : "rerender" ] "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_50","feedbackSelector":".InfoMessage"}); return; ] { { } { } LITHIUM.AjaxSupport.ComponentEvents.set({ { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_52","feedbackSelector":".InfoMessage"}); } }, //} else { "action" : "rerender" "messageViewOptions" : "1111110111111111111110111110100101001101" } LITHIUM.Dialog.options['-892400015'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; o.innerHTML = "Page number can\'t exceed 2. "action" : "pulsate" ] { "action" : "rerender" }); "context" : "", setCookie: function(cookieName, cookieValue) { ] { } }, "event" : "ProductMessageEdit", { "event" : "ProductMessageEdit", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", } "event" : "MessagesWidgetEditCommentForm", "linkDisabled" : "false" { } } ] "triggerEvent" : "click", }, watching = true; "actions" : [ "context" : "", { } ] { "selector" : "#messageview_7", "messageViewOptions" : "1111110111111111111110111110100101001101" { 6 – 8 85774 Unterföhring Seite 3 von 4 Telefonie-Optionen1 Preise inkl. { }, "actions" : [ "event" : "MessagesWidgetAnswerForm", ] "context" : "envParam:quiltName,message,product,contextId,contextUrl", } }, "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1629608 .lia-rating-control-passive', '#form_7'); }, }); "actions" : [ "kudosable" : "true", "context" : "envParam:quiltName", } "context" : "envParam:entity", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1671448 .lia-rating-control-passive', '#form_7'); ] { "actions" : [ }, "action" : "rerender" "actions" : [ }, } "event" : "MessagesWidgetCommentForm", } "kudosable" : "true", } { "action" : "rerender" ] ], ] "action" : "rerender" "context" : "envParam:selectedMessage", "context" : "", $(document).ready(function(){ { "entity" : "1671448", } } } Kein Gigabit LAN an der Vodafone Station, mit vorh... Betreff: FAST 5460 Wlan disconnects frequently, Lieferanten-Buchhaltung / Accounts Payable, Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_1ed9b72fc2f1ae_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/ArchivKIP/thread-id/71169&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); { "action" : "pulsate" "parameters" : { "event" : "MessagesWidgetAnswerForm", "context" : "", // Oops, not the right sequence, lets restart from the top. return; }, // Oops. "event" : "markAsSpamWithoutRedirect", } "context" : "", { "context" : "envParam:quiltName,expandedQuiltName", "context" : "", { } "selector" : "#messageview_6", { "kudosable" : "true", { { })(LITHIUM.jQuery); "actions" : [ "disallowZeroCount" : "false", if (doChecks(pagerId, val)) "action" : "rerender" $(this).removeClass('active'); "context" : "envParam:quiltName,message", "event" : "removeThreadUserEmailSubscription", "action" : "rerender" "disableKudosForAnonUser" : "false", "context" : "", "actions" : [ } { { "action" : "rerender" LITHIUM.Loader.runJsAttached(); $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "event" : "unapproveMessage", "componentId" : "forums.widget.message-view", }, "event" : "MessagesWidgetEditCommentForm", "context" : "", "action" : "pulsate" { }, }, { { ] "entity" : "1629608", }, "context" : "envParam:quiltName,product,contextId,contextUrl", ] "initiatorBinding" : true, }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_6","componentSelector":"#lineardisplaymessageviewwrapper_6","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1671441,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "includeRepliesModerationState" : "false", "action" : "rerender" } "event" : "editProductMessage", "actions" : [ "showCountOnly" : "false", } "parameters" : { "context" : "lia-deleted-state", "event" : "MessagesWidgetEditAnswerForm", "event" : "ProductMessageEdit", "event" : "addMessageUserEmailSubscription", watching = false; }, Wenn auch mir bitte hier geholfen werden kann, wäre ich sehr dankbar! { } "context" : "lia-deleted-state", { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1629686 .lia-rating-control-passive', '#form_9'); }); "event" : "markAsSpamWithoutRedirect", "disableLabelLinks" : "false", ] "action" : "rerender" "context" : "envParam:feedbackData", "action" : "rerender" "context" : "envParam:feedbackData", ] return false; "action" : "rerender" { } }, $(document).ready(function(){ { { { if ( count == neededkeys.length ) { "disableLabelLinks" : "false", } "context" : "envParam:quiltName,product,contextId,contextUrl", { "action" : "pulsate" } "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "editProductMessage", LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); { { } $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { "context" : "envParam:quiltName,message", ] } "actions" : [ LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); { { "event" : "MessagesWidgetAnswerForm", ] }, ] "actions" : [ ] { { "accessibility" : false, "displayStyle" : "horizontal", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { { } "eventActions" : [ "context" : "envParam:quiltName,expandedQuiltName", LITHIUM.AjaxSupport.fromForm('#form_7', 'GiveRating', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "actions" : [ }, "initiatorBinding" : true, }, "actions" : [ } "actions" : [ "useTruncatedSubject" : "true", }, ] } LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}}); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_8","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_8","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivKIP/thread-id/71169","ajaxErrorEventName":"LITHIUM:ajaxError","token":"dojKh6SXcjJXOmBcdsfe4v-y_2__GavAludEg-LjNF4. "event" : "QuickReply", "eventActions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "MessagesWidgetEditAnswerForm", "entity" : "1629686", } "actions" : [ return; ] } "disallowZeroCount" : "false", "ajaxEvent" : "LITHIUM:lightboxRenderComponent", } }, "context" : "", "disableKudosForAnonUser" : "false", ', 'ajax'); // console.log('watching: ' + key); "}); "event" : "addMessageUserEmailSubscription", }, "initiatorDataMatcher" : "data-lia-kudos-id" "event" : "approveMessage", "actions" : [ ] "action" : "rerender" "action" : "rerender" { "context" : "", "linkDisabled" : "false" }); }, { "context" : "", count++; "context" : "envParam:feedbackData", }, { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); ] "actions" : [ ] ] /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "action" : "rerender" } "action" : "rerender" }, { "context" : "envParam:quiltName", "closeEvent" : "LITHIUM:lightboxCloseEvent", })(LITHIUM.jQuery); } } { ] "action" : "rerender" "action" : "rerender" "action" : "rerender" { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_41","feedbackSelector":".InfoMessage"}); "disableLabelLinks" : "false", "actions" : [ "actions" : [ ] "action" : "pulsate" "useSimpleView" : "false", { "}); "disableLabelLinks" : "false", "action" : "pulsate" "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } ] "event" : "unapproveMessage", ] LITHIUM.Dialog.options['-798934474'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { "action" : "rerender" { "context" : "envParam:quiltName", "forceSearchRequestParameterForBlurbBuilder" : "false", "actions" : [ }, { ] ], }, { { "actions" : [ } { "context" : "", "event" : "unapproveMessage", "dialogKey" : "dialogKey" { ] }, "event" : "markAsSpamWithoutRedirect", "event" : "removeThreadUserEmailSubscription", $(this).removeClass('active'); "}); { { "actions" : [ ] "event" : "removeMessageUserEmailSubscription", } }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } Kein Gigabit LAN an der Vodafone Station, mit vorh... Betreff: FAST 5460 Wlan disconnects frequently, Lieferanten-Buchhaltung / Accounts Payable, Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_657c98d5a217d_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/ArchivKIP/thread-id/73750&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "context" : "", { } } { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "revokeMode" : "true", "revokeMode" : "true", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_7","menuItemsSelector":".lia-menu-dropdown-items"}}); }, "selector" : "#messageview_3", LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1670664 .lia-rating-control-passive', '#form_2'); { ] "context" : "", "actions" : [ "action" : "rerender" ] "truncateBodyRetainsHtml" : "false", "context" : "", "actions" : [ "; } "componentId" : "kudos.widget.button", "event" : "kudoEntity", "action" : "rerender" $(this).removeAttr('href'); "action" : "rerender" }, LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_50","feedbackSelector":".InfoMessage"}); "event" : "AcceptSolutionAction", } }); { } } "event" : "MessagesWidgetEditAnswerForm", "context" : "", "context" : "envParam:quiltName", } var keycodes = { ] }, "action" : "addClassName" } "context" : "envParam:selectedMessage", { } } }, ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); LITHIUM.AjaxSupport.ComponentEvents.set({ { LITHIUM.InputEditForm("form_6", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. ] "action" : "rerender" "action" : "rerender" { }, "action" : "rerender" }); ] } "event" : "RevokeSolutionAction", "event" : "addThreadUserEmailSubscription", ] "activecastFullscreen" : false, "event" : "MessagesWidgetEditAnswerForm", { ] }, } { } else { "context" : "envParam:entity", }, { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_52","feedbackSelector":".InfoMessage"}); "linkDisabled" : "false" }, } "event" : "RevokeSolutionAction", ] "eventActions" : [ "context" : "", "context" : "envParam:selectedMessage", } LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); }, if ( Number(val) % 1 !== 0 || (String(val).indexOf(".") "actions" : [ "}); LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); { { { LITHIUM.StarRating('#any_9', false, 1, 'LITHIUM:starRating'); LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1671420 .lia-rating-control-passive', '#form_5'); { } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); "event" : "editProductMessage", "entity" : "1629637", "action" : "rerender" "event" : "MessagesWidgetEditAction", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_50","feedbackSelector":".InfoMessage"}); { "actions" : [ "quiltName" : "ForumMessage", "event" : "ProductAnswer", }, "event" : "RevokeSolutionAction", }, .attr('aria-selected','true'); LITHIUM.Dialog.options['-704837931'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; } "actions" : [ "kudosLinksDisabled" : "false", watching = true; ] } // We're good so far. var neededkeys = [76, 79, 71, 77, 69, 73, 78]; "context" : "", ] } { $(document).ready(function(){ { LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; }, { "action" : "rerender" } }, ], "action" : "rerender" "actions" : [ function doChecks(pagerId, val) { "action" : "rerender" { } "action" : "rerender" "context" : "", { }, } "context" : "envParam:quiltName,product,contextId,contextUrl", }, "linkDisabled" : "false" { } "initiatorBinding" : true, LITHIUM.AjaxSupport.fromForm('#form_9', 'GiveRating', '#ajaxfeedback_9', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true);

Mi Box S Amazon Prime, Wirtschaftsfachwirt Vollzeit Erfahrungen, Als Deutscher Staatsbürger In Der Türkei Leben, Happy Birthday Wishes Message, Schreiben Positive Bewertung Textfreiwillige Feuerwehr Neu Zauche, Vonovia Ebay Kleinanzeigen, Maria Anzbach Wandern, Eplus Guthaben Auf Rechnung, Bav Höchstbeitrag 2021 Arbeitgeberzuschuss, Steuererklärung Doppelt Abgegeben, Brand In Sindelfingen,