"event" : "approveMessage", "context" : "", ;(function($) { }); }, "context" : "", $('.css-menu').removeClass('cssmenu-open') "context" : "envParam:feedbackData", // Oops. "event" : "addThreadUserEmailSubscription", "event" : "ProductAnswer", $(this).next().toggle(); { ', 'ajax'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_37","feedbackSelector":".InfoMessage"}); "}); "actions" : [ ', 'ajax'); "context" : "", { "action" : "rerender" { }, ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_44","feedbackSelector":".InfoMessage"}); "context" : "", LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } "context" : "", "quiltName" : "ForumMessage", { "disallowZeroCount" : "false", "kudosLinksDisabled" : "false", LITHIUM.DropDownMenu({"menuOffsetContainer":".lia-menu-offset-container","hoverLeaveEvent":"LITHIUM:hoverLeave","mouseoverElementSelector":".lia-js-mouseover-menu","menuOpenCssClass":"dropdownHover","clickElementSelector":".lia-js-click-menu","menuElementSelector":".lia-menu-navigation-wrapper","dialogSelector":".lia-panel-dialog-trigger","menuItemsSelector":".lia-menu-dropdown-items","menuClosedEvent":"LITHIUM:menuClosed","closeMenuEvent":"LITHIUM:closeMenu","menuOpenedEvent":"LITHIUM:menuOpened"}); ] { } { "action" : "addClassName" } { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "event" : "deleteMessage", watching = false; { } LITHIUM.MessageBodyDisplay('#bodyDisplay_8', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "}); "actions" : [ } } "event" : "RevokeSolutionAction", "context" : "", "message" : "1822044", "componentId" : "kudos.widget.button", "event" : "removeThreadUserEmailSubscription", ] { "action" : "rerender" ] }, { document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no"); "initiatorDataMatcher" : "data-lia-message-uid" ] "actions" : [ "context" : "envParam:quiltName", "context" : "envParam:quiltName", }, { LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, "event" : "MessagesWidgetEditCommentForm", $('#vodafone-community-header').toggle(); ] "actions" : [ }); Bist du sicher, dass du fortfahren möchtest? ] ] { }); } { "actions" : [ "linkDisabled" : "false" "context" : "envParam:quiltName", } "initiatorBinding" : true, // Oops, not the right sequence, lets restart from the top. } { "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" { "eventActions" : [ "useCountToKudo" : "false", } "action" : "rerender" "actions" : [ "buttonDialogCloseAlt" : "Schließen", ] "event" : "deleteMessage", }, "action" : "rerender" { LITHIUM.MessageBodyDisplay('#bodyDisplay_7', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { }, { { o.innerHTML = "Page must be in a numeric format. "event" : "QuickReply", "actions" : [ "action" : "rerender" { "context" : "envParam:quiltName", } "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_42","feedbackSelector":".InfoMessage"}); } function disableInput(pagerId) { ] "event" : "MessagesWidgetCommentForm", "actions" : [ "actions" : [ "actions" : [ "actions" : [ } "displayStyle" : "horizontal", } else { "context" : "", { }); "event" : "removeThreadUserEmailSubscription", ] }, "initiatorBinding" : true, "event" : "MessagesWidgetMessageEdit", ] > 0) ) ] "action" : "rerender" "actions" : [ "context" : "", "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_31","feedbackSelector":".InfoMessage"}); "revokeMode" : "true", } "event" : "ProductAnswer", } } "showCountOnly" : "false", "initiatorBinding" : true, { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_46","feedbackSelector":".InfoMessage"}); ] "entity" : "1825126", { "displaySubject" : "true", LITHIUM.MessageBodyDisplay('#bodyDisplay_4', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { o.innerHTML = "Page number must be 1 or greater. "useSimpleView" : "false", }, "context" : "", "eventActions" : [ ] } { })(LITHIUM.jQuery); "context" : "", "initiatorBinding" : true, "action" : "rerender" "action" : "rerender" } { ] "truncateBodyRetainsHtml" : "false", { "actions" : [ "event" : "AcceptSolutionAction", "context" : "", } { "initiatorBinding" : true, ] Bist du sicher, dass du fortfahren möchtest? ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "; }); "; { { ] count = 0; ] { "event" : "MessagesWidgetMessageEdit", { } "context" : "", } "actions" : [ "context" : "envParam:quiltName,product,contextId,contextUrl", clearWarning(pagerId); "useSubjectIcons" : "true", ] "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "rerender" ] { "event" : "MessagesWidgetCommentForm", "actions" : [ "selector" : "#messageview_4", "event" : "MessagesWidgetEditCommentForm", } "event" : "kudoEntity", "event" : "ProductAnswer", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, "disableLinks" : "false", LITHIUM.AjaxSupport.fromLink('#kudoEntity_7', 'kudoEntity', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {}, 'u_KoWMFxiQvQbT6sX6_xmUk7o8aRe_fSHaIHaJ22kCo. } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); { } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_42","feedbackSelector":".InfoMessage"}); "actions" : [ { "event" : "addMessageUserEmailSubscription", }, { }, "initiatorDataMatcher" : "data-lia-kudos-id" "action" : "rerender" } // We're good so far. { { "action" : "rerender" ","loaderSelector":"#lineardisplaymessageviewwrapper_7 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_21","feedbackSelector":".InfoMessage"}); } "truncateBodyRetainsHtml" : "false", { ] if ( Number(val) > 8 ) LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); }, LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, 'u1CPXaCdN0IPMOihB2RdsG0lR_QrZwlBWHaVPWlQipg. ', 'ajax'); "context" : "", { "action" : "rerender" "context" : "envParam:selectedMessage", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_41","feedbackSelector":".InfoMessage"}); "event" : "approveMessage", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ } ;(function($) { ] { "actions" : [ "selector" : "#kudosButtonV2_6", ] } "messageViewOptions" : "1111110111111111111110111110100101001101" "action" : "rerender" } ] } "initiatorBinding" : true, $(document).ready(function(){ "actions" : [ { { "}); "actions" : [ }, { ] } "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/GigaTV/thread-id/54/page/2","ajaxErrorEventName":"LITHIUM:ajaxError","token":"7kDMzw1MFZYl9iqx0B0RI7s2rOGalR7TORW17fScc90. { return; "kudosLinksDisabled" : "false", ] "context" : "", Zum Video: GigaTV Box einrichten Falls Du einen Router hast, schließ bitte zuerst den Router und danach die GigaTV Box an. } "actions" : [ { "event" : "AcceptSolutionAction", // If watching, pay attention to key presses, looking for right sequence. LITHIUM.Dialog.options['1837025174'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; ] $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); } { // enable redirect to login page when "logmein" is typed into the void =) }, ] "event" : "unapproveMessage", "context" : "lia-deleted-state", } "selector" : "#messageview_3", "context" : "envParam:quiltName,message,product,contextId,contextUrl", }, "actions" : [ lithstudio: [], "event" : "MessagesWidgetEditAction", ] { "actions" : [ "action" : "rerender" document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("disabled","1"); "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_39","feedbackSelector":".InfoMessage"}); ] { count = 0; "revokeMode" : "true", } "initiatorBinding" : true, Vodafone gigatv 4k box probleme. "actions" : [ }, "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "rerender" "event" : "addThreadUserEmailSubscription", "entity" : "1823369", "messageViewOptions" : "1111110111111111111110111110100101001101" "context" : "", { "actions" : [ }, "event" : "MessagesWidgetAnswerForm", ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ] }, ] "truncateBody" : "true", "actions" : [ { ] { { }, ] "parameters" : { "action" : "rerender" }, "context" : "", ] "event" : "MessagesWidgetEditAnswerForm", { }, "action" : "pulsate" } { LITHIUM.AjaxSupport.ComponentEvents.set({ }); ] "context" : "", { "context" : "envParam:quiltName", })(LITHIUM.jQuery); "action" : "rerender" ] }, } "actions" : [ ] } } "disableLabelLinks" : "false", "event" : "MessagesWidgetEditAction", } }, { "closeEvent" : "LITHIUM:lightboxCloseEvent", LITHIUM.AjaxSupport.fromLink('#kudoEntity_8', 'kudoEntity', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {}, 'qYbsiI_-I3KxB6dsdLKPyQpQ1sv4pxJpz7hyhM1k7jA. } ], "action" : "rerender" "actions" : [ } }, var o = document.getElementById("custom_board_pagination_warning" + pagerId); "action" : "rerender" "kudosable" : "true", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ } .attr('aria-selected','false'); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/GigaTV/thread-id/54","ajaxErrorEventName":"LITHIUM:ajaxError","token":"G0EWbsrLfaxvfv5qggE0CPvU1_tnY5MucSZI7drNLis. { "event" : "ProductAnswer", } "action" : "pulsate" "event" : "removeThreadUserEmailSubscription", { { "action" : "rerender" }); }, } "useTruncatedSubject" : "true", } "action" : "rerender" "disableLabelLinks" : "false", $('.menu-container').on('click','.community-user-menu-btn:not(.active)', {'selector' : '.css-user-menu'}, handleOpen); "disallowZeroCount" : "false", "event" : "expandMessage", { LITHIUM.AjaxSupport.useTickets = false; "kudosable" : "true", "actions" : [ } } } { "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_7","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_7","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/GigaTV/thread-id/54","ajaxErrorEventName":"LITHIUM:ajaxError","token":"17ck7Im0L5bmfK6y60rVJhE8wgRsfe36aufhCKCUxKo. expireDate.setDate(expireDate.getDate() + 365*10); "disableLabelLinks" : "false", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1825126 .lia-rating-control-passive', '#form_8'); "actions" : [ "action" : "rerender" })(LITHIUM.jQuery); "linkDisabled" : "false" "action" : "rerender" "actions" : [ .attr('aria-hidden','false') "kudosable" : "true", { } { } "quiltName" : "ForumMessage", //$('#vodafone-community-header').css('display','block'); "actions" : [ { { "actions" : [ ] "event" : "MessagesWidgetEditCommentForm", "displaySubject" : "true", "linkDisabled" : "false" } { "action" : "rerender" "event" : "kudoEntity", "disallowZeroCount" : "false", // console.log('watching: ' + key); LITHIUM.AjaxSupport.fromForm('#form_8', 'GiveRating', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); o.innerHTML = "Page must be an integer number. { }, }, "event" : "RevokeSolutionAction", } "context" : "envParam:entity", { "action" : "rerender" "action" : "rerender" document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div"); }, "event" : "kudoEntity", ', 'ajax'); { ] // Reset the conditions so that someone can do it all again. } { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "initiatorDataMatcher" : "data-lia-kudos-id" "action" : "pulsate" "forceSearchRequestParameterForBlurbBuilder" : "false", { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { ] ], "context" : "", "context" : "envParam:quiltName", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "initiatorBinding" : true, "event" : "expandMessage", ] { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }, "actions" : [ ] "actions" : [ { var handleOpen = function(event) { ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, Hast Du Deine GigaTV 4K Box angeschlossen, tren­nt Dich nur noch ein klein­er Schritt vom ulti­ma­tiv­en TV-Erleb­nis. { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); }, "action" : "rerender" { var watching = false; ] } "action" : "rerender" "context" : "envParam:feedbackData", }); ] "message" : "1823003", "action" : "rerender" }, } { "action" : "rerender" { { "actions" : [ "componentId" : "kudos.widget.button", "actions" : [ // console.log('watching: ' + key); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_35","feedbackSelector":".InfoMessage"}); if (isNaN(val) ) { "displayStyle" : "horizontal", "action" : "rerender" { "context" : "envParam:quiltName", "event" : "removeMessageUserEmailSubscription", "action" : "rerender" { "actions" : [ }, "context" : "envParam:quiltName,message,product,contextId,contextUrl", "closeImageIconURL" : "https://forum.vodafone.de/skins/images/3633B7E3512025038504892977369C15/responsive_peak/images/button_dialog_close.svg", }, { }, "actions" : [ "event" : "kudoEntity", "event" : "ProductAnswerComment", "event" : "MessagesWidgetMessageEdit", "context" : "envParam:quiltName,message", "context" : "lia-deleted-state", { }, "action" : "rerender" "actions" : [ { "actions" : [ "action" : "rerender" } ] "actions" : [ ] "eventActions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_40","feedbackSelector":".InfoMessage"}); "event" : "unapproveMessage", { } var o = document.getElementById("custom_board_pagination_warning" + pagerId); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", Meist Musiksender, \\n\\t\\t\\t\\n\\t\\n\\n\\t\\n\\n\\t\\t\";LITHIUM.AjaxSupport.defaultAjaxErrorHtml = \", \\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\t\\t, '; "actions" : [ LITHIUM.MessageBodyDisplay('#bodyDisplay_3', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "useSubjectIcons" : "true", Sender, Inhalte und der Preis überzeugen. disableInput(pagerId); "action" : "rerender" }, { "action" : "rerender" "actions" : [ window.scrollTo(0,position_x.top - 150); }, ;(function($) { watching = true; "disableLabelLinks" : "false", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); Bist du sicher, dass du fortfahren möchtest? ] "disallowZeroCount" : "false", '; "context" : "", "context" : "", "action" : "rerender" "context" : "", "context" : "envParam:quiltName,product,contextId,contextUrl", "event" : "MessagesWidgetEditAction", "action" : "rerender" "eventActions" : [ LITHIUM.StarRating('#any', false, 1, 'LITHIUM:starRating'); "actions" : [ } "event" : "MessagesWidgetAnswerForm", } "actions" : [ { "event" : "editProductMessage", ] { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "actions" : [ }, }, { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_38","feedbackSelector":".InfoMessage"}); }, } { "action" : "rerender" "actions" : [ if (val.trim() == "") } // Oops. "context" : "", "action" : "rerender" } "event" : "markAsSpamWithoutRedirect", "parameters" : { }, ] "context" : "", "context" : "envParam:quiltName,message", "actions" : [ ] "event" : "markAsSpamWithoutRedirect", "action" : "rerender" "action" : "rerender" }, "useSimpleView" : "false", "actions" : [ }, }, "event" : "MessagesWidgetAnswerForm", "linkDisabled" : "false" ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ] "componentId" : "forums.widget.message-view", }, } "}); ] }, LITHIUM.StarRating('#any_0_4', true, 2, 'LITHIUM:starRating'); }, "context" : "envParam:quiltName", clearWarning(pagerId); })(LITHIUM.jQuery); "actions" : [ } } { var ctaHTML = ''; if ( key == neededkeys[0] ) { Stell den Router möglichst in die Nähe der GigaTV Box auf. } { ] LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1823292 .lia-rating-control-passive', '#form_5'); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); } } "showCountOnly" : "false", }, "action" : "rerender" }, LITHIUM.InputEditForm("form_6", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "actions" : [ } { "selector" : "#kudosButtonV2_0", ] "context" : "", { }, LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.StarRating('#any_0_6', true, 2, 'LITHIUM:starRating'); "event" : "editProductMessage", "parameters" : { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { } "forceSearchRequestParameterForBlurbBuilder" : "false", "action" : "rerender" } disableInput(pagerId); "action" : "rerender" "context" : "", }, LITHIUM.AjaxSupport.fromLink('#kudoEntity_5', 'kudoEntity', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {}, 'bL5oIJQBxihCOTaBfpurK0pFtxqvKif8ai0a1WNlIsM. "actions" : [ { }; }, "action" : "rerender" $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "actions" : [ LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, '45ERj6hF6ivK3ZVFkygEWdhr66BRCP9Oh_tbzPDFYAM. "kudosable" : "true", "disallowZeroCount" : "false", }, "context" : "envParam:quiltName,expandedQuiltName", count++; "event" : "MessagesWidgetMessageEdit", }); { }, "action" : "rerender" LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); }, { "context" : "", "truncateBody" : "true", ] { LITHIUM.AjaxSupport.fromForm('#form_8', 'GiveRating', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); })(LITHIUM.jQuery); { }, "action" : "rerender" LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_8","menuItemsSelector":".lia-menu-dropdown-items"}}); "event" : "kudoEntity", ] "context" : "", "kudosLinksDisabled" : "false", }, "quiltName" : "ForumMessage", "revokeMode" : "true", "eventActions" : [ { "initiatorDataMatcher" : "data-lia-kudos-id" { ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_6","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_6","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/GigaTV/thread-id/54","ajaxErrorEventName":"LITHIUM:ajaxError","token":"XcCSapd4kC6rzZDI8bcHXVaVkbyudPwERTdOk1iJS1s.