"action" : "pulsate" LITHIUM.InputEditForm("form_7", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "action" : "rerender" }, ] LITHIUM.AjaxSupport.ComponentEvents.set({ "disableKudosForAnonUser" : "false", "action" : "rerender" "initiatorBinding" : true, } LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ { { Bist du sicher, dass du fortfahren möchtest? "eventActions" : [ }, "actions" : [ ] "context" : "envParam:quiltName,message", "event" : "RevokeSolutionAction", ] { "event" : "ProductMessageEdit", }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", ] }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "message" : "1143304", "useCountToKudo" : "false", "initiatorBinding" : true, "displaySubject" : "true", Bist du sicher, dass du fortfahren möchtest? "event" : "MessagesWidgetEditAnswerForm", { LITHIUM.AjaxSupport.ComponentEvents.set({ ] { { "event" : "ProductAnswerComment", ] } // enable redirect to login page when "logmein" is typed into the void =) { }, "context" : "", "context" : "", "action" : "addClassName" "useTruncatedSubject" : "true", "buttonDialogCloseAlt" : "Schließen", "includeRepliesModerationState" : "false", } }, "action" : "rerender" { "action" : "pulsate" { { ] LITHIUM.StarRating('#any_3', false, 1, 'LITHIUM:starRating'); ] } "action" : "rerender" LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_7","menuItemsSelector":".lia-menu-dropdown-items"}}); "event" : "kudoEntity", "componentId" : "kudos.widget.button", }, "event" : "MessagesWidgetEditCommentForm", ] If you can get into your APN, change or add the APN Protocol value to "IPv4" only If you think I helped please feel free to hit the "Thumbs Up" button below. }, { { "displaySubject" : "true", ] { LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. }); "event" : "MessagesWidgetEditCommentForm", { "action" : "rerender" } { "context" : "", "triggerEvent" : "click", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_36","feedbackSelector":".InfoMessage"}); "actions" : [ LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } "}); ] "parameters" : { }, "forceSearchRequestParameterForBlurbBuilder" : "false", ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { "event" : "addMessageUserEmailSubscription", "event" : "removeMessageUserEmailSubscription", "disableKudosForAnonUser" : "false", "actions" : [ "disableKudosForAnonUser" : "false", "disableLabelLinks" : "false", "event" : "unapproveMessage", Vodafone modem: If you are using a Vodafone modem, these settings should not be changed on your modem. "context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "addClassName" } "event" : "MessagesWidgetMessageEdit", ] "actions" : [ lithstudio: [], LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "", IPv6 Prefixes 3000. { } { { "context" : "", ] "}); { } "event" : "removeThreadUserEmailSubscription", ] count = 0; "actions" : [ "action" : "rerender" ] } "event" : "ProductMessageEdit", "actions" : [ }); LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "action" : "rerender" }, "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" { }, ] } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { { "actions" : [ "linkDisabled" : "false" LITHIUM.InputEditForm("form_6", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "disableKudosForAnonUser" : "false", "actions" : [ ] } ] { "context" : "envParam:entity", "revokeMode" : "true", { }, "event" : "markAsSpamWithoutRedirect", "kudosLinksDisabled" : "false", { ] }, { { } "action" : "pulsate" var keycodes = { LITHIUM.Tooltip({"bodySelector":"body#lia-body","delay":30,"enableOnClickForTrigger":false,"predelay":10,"triggerSelector":"#link_1edc8003edeb44","tooltipContentSelector":"#link_1edc8003edeb44_0-tooltip-element .content","position":["bottom","left"],"tooltipElementSelector":"#link_1edc8003edeb44_0-tooltip-element","events":{"def":"focus mouseover,blur mouseout"},"hideOnLeave":true}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1143306 .lia-rating-control-passive', '#form_4'); } "useTruncatedSubject" : "true", "entity" : "1143308", }, { } //$('#vodafone-community-header').css('display','block'); "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); // Set start to true only if the first key in the sequence is pressed "disableKudosForAnonUser" : "false", "kudosable" : "true", "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_41","feedbackSelector":".InfoMessage"}); { ] "eventActions" : [ } ] { "action" : "pulsate" ] "action" : "rerender" $(document).ready(function(){ LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. }, LITHIUM.AjaxSupport.ComponentEvents.set({ }, "actions" : [ { }, "context" : "", })(LITHIUM.jQuery); "action" : "rerender" { "eventActions" : [ "actions" : [ // console.log('watching: ' + key); { ] { "disallowZeroCount" : "false", "event" : "unapproveMessage", After IPv4, IPv5 was designed as a private experimental streaming system. { "context" : "lia-deleted-state", "context" : "envParam:quiltName", "event" : "MessagesWidgetEditCommentForm", "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", }, } ] "action" : "addClassName" }, LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); ] "showCountOnly" : "false", } "context" : "envParam:selectedMessage", "quiltName" : "ForumMessage", "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ } } "context" : "envParam:quiltName,expandedQuiltName", } "actions" : [ { "action" : "rerender" "componentId" : "forums.widget.message-view", "linkDisabled" : "false" { "initiatorDataMatcher" : "data-lia-message-uid" "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ { "event" : "AcceptSolutionAction", "context" : "", { } "forceSearchRequestParameterForBlurbBuilder" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); "context" : "envParam:entity", }, "actions" : [ LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); "event" : "ProductAnswerComment", ] { "useSubjectIcons" : "true", "buttonDialogCloseAlt" : "Schließen", ] "action" : "rerender" "action" : "rerender" { } { { "action" : "rerender" { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); "parameters" : { { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); LITHIUM.Auth.CHECK_SESSION_TOKEN = 'kWX2AMKtcQ6Bacp4gRVCenhYctJSnFRbhT6JvtVujpw. I'll double check, thought IPv6 was already rolled out }, "context" : "envParam:quiltName,product,contextId,contextUrl", { "action" : "rerender" ] "context" : "", ] } "actions" : [ }, "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_27","feedbackSelector":".InfoMessage"}); "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ } "action" : "rerender" ] ] LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1143305 .lia-rating-control-passive', '#form_3'); var cookieDomain = 'forum.vodafone.de'; }, { "selector" : "#kudosButtonV2_2", $(this).toggleClass("view-btn-open view-btn-close"); "event" : "ProductAnswer", "event" : "markAsSpamWithoutRedirect", "eventActions" : [ } LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" "disallowZeroCount" : "false", Verbindungen zu auf Internet- Protokoll Version 4 (IPv4) basierenden Diensten werden über ein zentrales Network-Address- Translation-Gateway (NAT-Gateway) ermöglicht. } } }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); "event" : "MessagesWidgetAnswerForm", "context" : "", }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1143305 .lia-rating-control-passive', '#form_3'); ] "componentId" : "kudos.widget.button", { "initiatorDataMatcher" : "data-lia-kudos-id" "actions" : [ ] } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_6","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_6","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivKIP/thread-id/17791","ajaxErrorEventName":"LITHIUM:ajaxError","token":"QL6iP-yIcHB5J7GsVXxTnQg7-v7wXVYGY45vRL5YBXA. { "context" : "", ] { LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234270}); }, { } "event" : "markAsSpamWithoutRedirect", } "event" : "QuickReply", }, "parameters" : { "eventActions" : [ "entity" : "1143301", ] "action" : "rerender" } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, "event" : "MessagesWidgetEditCommentForm", "actions" : [ "action" : "rerender" } ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { "event" : "unapproveMessage", LITHIUM.AjaxSupport.fromForm('#form_6', 'GiveRating', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { Bist du sicher, dass du fortfahren möchtest? LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); "context" : "", "action" : "rerender" { }, { "event" : "AcceptSolutionAction", "actions" : [ "event" : "MessagesWidgetCommentForm", }, "event" : "MessagesWidgetAnswerForm", { "event" : "markAsSpamWithoutRedirect", } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } "eventActions" : [ { "action" : "pulsate" $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "actions" : [ { "event" : "MessagesWidgetCommentForm", "action" : "addClassName" "actions" : [ { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); "actions" : [ "eventActions" : [ }, ] ] "selector" : "#messageview", "selector" : "#messageview_6", "useCountToKudo" : "false", { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivKIP/thread-id/17791","ajaxErrorEventName":"LITHIUM:ajaxError","token":"8rDh3AF0MALD8UVV0EJGWOc9ypBvqShqbHf7nlb_l1Y. }, ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); "action" : "rerender" "dialogContentCssClass" : "lia-panel-dialog-content", } "event" : "MessagesWidgetAnswerForm", { }, "action" : "rerender" "context" : "envParam:quiltName", } } "context" : "envParam:quiltName", { ] ] } } "action" : "rerender" "event" : "addThreadUserEmailSubscription", { "context" : "envParam:quiltName", } watching = false; Bist du sicher, dass du fortfahren möchtest? "context" : "", watching = false; }, 2. LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; document.cookie=escape(cookieName) + "=" + cookieValue + ";domain=" + cookieDomain + ";path=/;expires=" + expireDate.toUTCString(); }, "kudosable" : "true", LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); "event" : "kudoEntity", { count = 0; "action" : "rerender" }); }; /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }, "kudosable" : "true", "eventActions" : [ "actions" : [ { { ] })(LITHIUM.jQuery); "action" : "rerender" "action" : "rerender" "event" : "expandMessage", "event" : "removeThreadUserEmailSubscription", { { "context" : "", { "action" : "rerender" ] "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_44","feedbackSelector":".InfoMessage"}); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "actions" : [ "event" : "unapproveMessage", { }, "action" : "rerender" } "event" : "MessagesWidgetEditCommentForm", { { }, "parameters" : { { ] "event" : "editProductMessage", LITHIUM.MessageBodyDisplay('#bodyDisplay_3', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { "entity" : "1143307", LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_40","feedbackSelector":".InfoMessage"}); "context" : "", } } LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}}); }, "disallowZeroCount" : "false", "eventActions" : [ "disableKudosForAnonUser" : "false", "context" : "", "context" : "", "action" : "rerender" "event" : "addThreadUserEmailSubscription", { "actions" : [ { You will probably need to set up a DHCP address reservation for your NVR in Advanced > Additional Settings so that it always gets the same IP address, and then use that address … LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); { { "event" : "MessagesWidgetAnswerForm", "event" : "markAsSpamWithoutRedirect", "event" : "removeMessageUserEmailSubscription", "actions" : [ "context" : "envParam:quiltName,message", { "event" : "AcceptSolutionAction", "action" : "rerender" } "event" : "MessagesWidgetAnswerForm", } "actions" : [ "revokeMode" : "true", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { } "initiatorDataMatcher" : "data-lia-kudos-id" "quiltName" : "ForumMessage", "}); "}); //$('#lia-body').addClass('lia-window-scroll'); } "event" : "QuickReply", "actions" : [ } "actions" : [ }, "context" : "envParam:quiltName", "context" : "envParam:selectedMessage", ] { { ] "actions" : [ { "context" : "envParam:quiltName", "event" : "removeMessageUserEmailSubscription", LITHIUM.Auth.CHECK_SESSION_TOKEN = 'kWX2AMKtcQ6Bacp4gRVCenhYctJSnFRbhT6JvtVujpw. "}); } "actions" : [ LITHIUM.MessageBodyDisplay('#bodyDisplay_6', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "disallowZeroCount" : "false", Bist du sicher, dass du fortfahren möchtest? ', 'ajax'); "action" : "rerender" "action" : "rerender" { "actions" : [ { { } $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "context" : "envParam:quiltName,message,product,contextId,contextUrl", }, { "action" : "rerender" "actions" : [ }, } LITHIUM.Dialog({ element.siblings('li').children('ul').slideUp(); "event" : "approveMessage", "selector" : "#messageview_7", }, "messageViewOptions" : "1111110111111111111110111110100101001101" } "event" : "MessagesWidgetCommentForm", ] LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1143306 .lia-rating-control-passive', '#form_4'); ] { "useSimpleView" : "false", "}); } { "action" : "rerender" "initiatorBinding" : true, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { "truncateBody" : "true", "context" : "", { "actions" : [ "action" : "rerender" "context" : "envParam:quiltName", ] ] { }, "action" : "rerender" { "action" : "rerender" } } "context" : "", var keycodes = { "selector" : "#messageview_4", } }, { "actions" : [ ] } LITHIUM.AjaxSupport.ComponentEvents.set({ { "selector" : "#kudosButtonV2_6", { ] function createStorage(option){ { { "event" : "expandMessage", }); { "action" : "rerender" { { "event" : "approveMessage", "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "MessagesWidgetEditAnswerForm", } "kudosable" : "true", "actions" : [ }, { ], { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/ArchivKIP/thread-id/17791","ajaxErrorEventName":"LITHIUM:ajaxError","token":"tN1GNDw7MHhAvgs41rbL07LNlKrVbPItH29z-FwI_Vo. "event" : "ProductAnswerComment", "actions" : [ "actions" : [ "actions" : [ "actions" : [ }, "context" : "lia-deleted-state", { "event" : "deleteMessage", "initiatorBinding" : true, "context" : "", })(LITHIUM.jQuery); { { "useSubjectIcons" : "true", }, } "context" : "", IP addresses assigned for VF DSL customers 130.0.176.0/20: IP addresses assigned for VF DSL customers ... IPv4 Peer; 1: Vodafone Group PLC (Cable and Wireless) X: AS1273: 2: Hurricane Electric LLC ... 2018-11-22T15:27:33Z last-modified: 2018-11-22T15:27:33Z source: RIPE aut-num: AS30722 as-name: VODAFONE … "linkDisabled" : "false" "componentId" : "kudos.widget.button", "disableLabelLinks" : "false", { "action" : "pulsate" } { })(LITHIUM.jQuery); "context" : "envParam:entity", "event" : "ProductAnswer", "disallowZeroCount" : "false", "event" : "kudoEntity", ] LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1143308 .lia-rating-control-passive', '#form_6'); "event" : "removeMessageUserEmailSubscription", "event" : "MessagesWidgetMessageEdit", ] } "useSubjectIcons" : "true", "dialogContentCssClass" : "lia-panel-dialog-content", ] "actions" : [ }, { "context" : "", "event" : "removeMessageUserEmailSubscription", "action" : "rerender" }, { { { { "context" : "", }, "useCountToKudo" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_36","feedbackSelector":".InfoMessage"}); expireDate.setDate(expireDate.getDate() + 365*10); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_16","feedbackSelector":".InfoMessage"}); "displaySubject" : "true", "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" { "initiatorDataMatcher" : "data-lia-kudos-id" "entity" : "1143306", "actions" : [ "actions" : [ "disableKudosForAnonUser" : "false", "entity" : "1143306", "actions" : [ } LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); "actions" : [ "actions" : [ ] ] "actions" : [ { "actions" : [ "action" : "rerender" "action" : "rerender" "displaySubject" : "true", LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "envParam:quiltName,message", LITHIUM.AjaxSupport.ComponentEvents.set({ ] "actions" : [ "disableLinks" : "false", "action" : "rerender" "actions" : [ ] Execute whatever should happen when entering the right sequence "}); "actions" : [ "context" : "", }, } }, LITHIUM.AjaxSupport.ComponentEvents.set({ } Als eigenen Router kannst du jedes Gerät nutzen, wo sich das -wenn vorhanden - DSL-Modem abschalten lässt. }, "action" : "rerender" "context" : "lia-deleted-state", {